PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00055g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 412aa    MW: 45206.3 Da    PI: 4.9211
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00055g00010.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.55e-07444539
                  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                              +C+ ++e++ + +C+++   lC +C  ++H+       H++
  Peinf101Scf00055g00010.1  4 TCEVCGEQRSIVYCRSDAASLCLSCDRNIHSAnalsrrHSR 44
                              7*****************************65677777766 PP

2zf-B_box26.21.6e-084688440
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                               +C++++++++   C + +  lC++C  ++H +      H+++
  Peinf101Scf00055g00010.1 46 LVCERCNSQPAVSRCVEERISLCQNCDWTGHARsssgstHKRQ 88
                              68*****************************888899999876 PP

3CCT58.91.7e-20355398144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               R  a+lRYkeK+k R+F+K++rY+sRKa+A+ R RvKGrFvk+ 
  Peinf101Scf00055g00010.1 355 RSDAVLRYKEKKKMRQFDKRVRYASRKARADVRRRVKGRFVKAG 398
                               889**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.442147IPR000315B-box-type zinc finger
SMARTSM003363.7E-8447IPR000315B-box-type zinc finger
CDDcd000211.43E-6547No hitNo description
PROSITE profilePS501198.6314390IPR000315B-box-type zinc finger
CDDcd000216.72E-54778No hitNo description
SMARTSM0033634890IPR000315B-box-type zinc finger
PfamPF062033.5E-15355397IPR010402CCT domain
PROSITE profilePS5101715.051355397IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGYTCEVCGE QRSIVYCRSD AASLCLSCDR NIHSANALSR RHSRTLVCER CNSQPAVSRC  60
VEERISLCQN CDWTGHARSS SGSTHKRQAL SCYTGCPSAA ELSITWSFLL DDPSVGNLTC  120
EQGMGSMRIN DCRPGESQGS QVKDKSQDMN AAVEANDSRN SDKYTLLMGS SMPSLDNKLE  180
IDELPVGSTN FTWSKVSNSG MKGSNLFDDD PFCEDFNMDE VDLSVENYEE LFGVSLDNPD  240
LLFENEGLRG FFGTKDMSVA ESSCQGFNAA EGSAVGKVST MQPACSNAAS AESTMSCKTE  300
PILCFARQAQ SSLSFSNLTG ESSAGDYQDC GASSMLLMGE PPWCPPESSM PSTSRSDAVL  360
RYKEKKKMRQ FDKRVRYASR KARADVRRRV KGRFVKAGDA YDYDPLSETR SY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009768364.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_009768363.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_016460898.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_016460897.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_016460896.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9LUA91e-134COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLM1BGT70.0M1BGT7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000448770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12702468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-124B-box type zinc finger protein with CCT domain